logo
  • Home
  • Products
  • Manufacturers

  • hot searches:
  • More>>
About 202 products for meat grinding equipment (0.001)
 Pet Dog Cat Food Pellet Production Equipment Line Machinery Pet Food Production Line Price
Pet Dog Cat Food Pellet Production Equipment Line Machinery ...

Desc:Pet Dog Cat Food Pellet Production Equipment Line Machinery pet food production line priceProduction line Description1).Allpetfoodequipmentsaremadeofs...

2024-01-15

 Stainless Steel Meat Grinder Part
Stainless Steel Meat Grinder Part

Desc: Product Name: Investment Casting / Foundry Materials:Alloy steels, stainless steels Items: FOB NingBo or Shanghai Lead time: 30 days Place of Origin:...

2024-02-07

 Hot Sell Feed Processing Equipment Dog Cat Floating Fish Pellet Making Machine Fish Feed Extruder
Hot Sell Feed Processing Equipment Dog Cat Floating Fish Pel...

Desc:Hot Sell Feed Processing Equipment Dog Cat Floating Fish Pellet Making Machine Fish Feed Extruder1.Description of FloatingFishFeedPelletMachineExtrude...

2024-01-15

 Ycl Series Single-Phase Motor Noodle Grinding Machine Vacuum Equipment Sealing Machine Motor
Ycl Series Single-Phase Motor Noodle Grinding Machine Vacuum...

Desc:Motor modelYCL seriessingle-phase asynchronous motortexture of materialIron shellInstallation methodhorizontalpower1HP-8HPApplicable scopeYCL iron she...

2024-04-07

 Factory Customized Food Processing Parts Meat Grinder Slicer Parts
Factory Customized Food Processing Parts Meat Grinder Slicer...

Desc: We offer Customized Precision OEM/ODM precision Metal/Aluminum CNC Machining Part for Industry Robot/Robotics, CNC machining parts for Bearing Sleeve...

2024-02-07

 Fish Beef Pork Meatball Processing Production Line for Sale
Fish Beef Pork Meatball Processing Production Line for Sale

Desc:The Main Processing Procedure of Meatball Production Line:One: Flow Chart :A. The procedure of making fish meatball1. Raw fish Fish ScalingFish skinni...

2024-01-16

 Energy Saving Sawing Machine Bone Band Bone Saw Machine
Energy Saving Sawing Machine Bone Band Bone Saw Machine

Desc:High efficiency bone saw machine bone crushing machine Bonecrushingmachineisanewefficientclawtypegrindingequipmentusedtocrushallkindsofbonesefficientl...

2024-01-20

 Stainless Steel Manual Hand Press Juicer Factory Price
Stainless Steel Manual Hand Press Juicer Factory Price

Desc:Hand Press Vegetable and Fruit Juicer Extractor Machine Commercial Bar Equipment Manual Orange Citrus Juicer WHAT IS THE SPECIFICATIONS OF OUR ? Compa...

2024-02-07

 Stainless Steel Manual Hand Press Juicer Factory Price
Stainless Steel Manual Hand Press Juicer Factory Price

Desc:Hand Press Vegetable and Fruit Juicer Extractor Machine Commercial Bar Equipment Manual Orange Citrus Juicer WHAT IS THE SPECIFICATIONS OF OUR ? Compa...

2024-02-07

 Professional Textured Vegetable Making Machine
Professional Textured Vegetable Making Machine

Desc:Description:This Soy Bean Meat Protein Soya Chunk Nugget Extruder Machine line adopts low-temperature soyabean powder as main material to produce new ...

2024-01-25

 Serrated Edge Steak Knife Lines
Serrated Edge Steak Knife Lines

Desc: China knives manufacturer,serrated table top steak knives,kitchen steak knife,serrated knives and other chef's knives,kitchen knives. W e have b...

2024-04-07

 Automatic Fresh Corn Thresher Sweet Thresher Machine for Food Processing Machine
Automatic Fresh Corn Thresher Sweet Thresher Machine for Foo...

Desc: Meat Fruit vegetables Washing Machine Brief Introduction Automatic Fresh Corn Thresher Sweet Thresher Machine for Food Processing Mach...

2024-01-19

 Dog Biscuit Production Line Dog and Cat Food Machines Cold Pressed Dog Food Making Machinery
Dog Biscuit Production Line Dog and Cat Food Machines Cold P...

Desc:Product Description1.What is dog biscuit production line?Pet Biscuit Processing Line has original design, compact structure and high automation, is de...

2024-01-19

 Automatic Dog Biscuits Making Processing Machine Line Pet Snack Extruder
Automatic Dog Biscuits Making Processing Machine Line Pet Sn...

Desc:Product Description1.What is dog biscuit production line?Pet Biscuit Processing Line has original design, compact structure and high automation, is de...

2024-01-19

 Stainless Steel Precision Multifunctional Corn Wheat Food Milling Machine
Stainless Steel Precision Multifunctional Corn Wheat Food Mi...

Desc:Stainless steel precision multifunctional corn wheat food milling machineProduct DescriptionThis industrial powder grinding machine can grind powder a...

2024-01-18

    prev 1 2 3 4 5 next

Hot Product : A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z | 0~9

Home | Products | Manufacturers | About Us | Advertise | Contact Us | SiteMap |

Powered by Win Cok Products Software Technology Co., Ltd.